PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Jcr4S05184.20
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha
Family G2-like
Protein Properties Length: 172aa    MW: 19037.8 Da    PI: 10.8598
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Jcr4S05184.20genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like105.53.1e-331872155
        G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                   kprlrWt++LH+rFv+av++LGG++kAtPk++l+lm++kgLtl+h+kSHLQkYRl
  Jcr4S05184.20 18 KPRLRWTSDLHHRFVDAVTKLGGPHKATPKSVLRLMGLKGLTLYHLKSHLQKYRL 72
                   79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.0891575IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.3E-321575IPR009057Homeodomain-like
TIGRFAMsTIGR015579.6E-251873IPR006447Myb domain, plants
SuperFamilySSF466894.48E-161875IPR009057Homeodomain-like
PfamPF002499.5E-92071IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 172 aa     Download sequence    Send to blast
MERMYENIGG VVMTRDPKPR LRWTSDLHHR FVDAVTKLGG PHKATPKSVL RLMGLKGLTL  60
YHLKSHLQKY RLGQQQARKQ NTKQHSQENT GMSYVNFGNN SSGLATASSP VNDQPRNDKK  120
RQGGVGMATG SVLTGTEPYC RRTGTGLKPA VHNFEPEPAV QGPVKVHVDV KI
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00544DAPTransfer from AT5G45580Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012081067.11e-78PREDICTED: myb family transcription factor APL
TrEMBLA0A067KES56e-93A0A067KES5_JATCU; Uncharacterized protein
STRINGBra025071.1-P4e-48(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF51013142
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G45580.13e-48G2-like family protein